PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00059637001
Common NameGSBRNA2T00059637001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family G2-like
Protein Properties Length: 328aa    MW: 37388.7 Da    PI: 9.4358
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00059637001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like99.62.2e-3154107255
              G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                          prlrWtp+LH +Fv+av++LGG+++AtPk +l++m++kgL+++hvkSHLQ+YR+
  GSBRNA2T00059637001  54 PRLRWTPDLHLSFVRAVQRLGGPHRATPKMVLQMMNLKGLSIAHVKSHLQMYRS 107
                          8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.60150110IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.3E-2850108IPR009057Homeodomain-like
SuperFamilySSF466891.52E-1354108IPR009057Homeodomain-like
TIGRFAMsTIGR015572.2E-2254109IPR006447Myb domain, plants
PfamPF002492.8E-855106IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 328 aa     Download sequence    Send to blast
MDGTSSREKC AMWLDLNREE AVEKYNEEES SVEDEDQQVT SSNNVRQYVR SNMPRLRWTP  60
DLHLSFVRAV QRLGGPHRAT PKMVLQMMNL KGLSIAHVKS HLQMYRSKKL EATSLHEVGA  120
MMGARRNYLL DMIDIPYGGL RHACYPKTVP SREHNQGTVF TNLGANFVMR PSSWCNRSSG  180
HELNNVRGGL NRESMESKTL PLLEEGDPRE KSPRRRGKRS TISQTIKTNE RRWDQHDALA  240
VSVLNIIRRV TVVMASDIVE TIWVRLDSDP TELSVDKLMR ETDTIKFRAD RSSVESSLGL  300
RLRKRTCLAL EAASLIEKGF ECIFNCL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013724349.11e-134PREDICTED: uncharacterized protein LOC106428148
RefseqXP_009133548.11e-134PREDICTED: uncharacterized protein LOC103858025
TrEMBLA0A078JP450.0A0A078JP45_BRANA; BnaA03g56690D protein
STRINGBra000270.1-P1e-178(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM36328184
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G42660.14e-82G2-like family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]